CAPNS1 Rabbit Polyclonal Antibody

CAT#: TA344345

Rabbit Polyclonal Anti-CAPNS1 Antibody - middle region



Need it in bulk or conjugated?
Get a free quote

CNY 4,628.00


货期*
2周

规格
    • 50 ug

Product images

经常一起买 (4)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1,430.00


Recombinant protein of human calpain, small subunit 1 (CAPNS1), transcript variant 2, 20 µg
    • 20 ug

CNY 2,900.00
CNY 6,650.00


Transient overexpression lysate of calpain, small subunit 1 (CAPNS1), transcript variant 1
    • 100 ug

CNY 3,080.00


Recombinant protein of human calpain, small subunit 1 (CAPNS1), transcript variant 2, 100 µg
    • 100 ug

CNY 9,998.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-CAPNS1 antibody: synthetic peptide directed towards the middle region of human CAPNS1. Synthetic peptide located within the following region: RRYSDESGNMDFDNFISCLVRLDAMFRAFKSLDKDGTGQIQVNIQEWLQL
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 29 kDa
Gene Name calpain small subunit 1
Background Calpains are a ubiquitous, well-conserved family of calcium-dependent, cysteine proteases. Calpain families have been implicated in neurodegenerative processes, as their activation can be triggered by calcium influx and oxidative stress. Calpain I and II are heterodimeric with distinct large subunits associated with common small subunits, all of which are encoded by different genes. This gene encodes a small subunit common to both calpain I and II and is associated with myotonic dystrophy. Two transcript variants encoding the same protein have been identified for this gene.
Synonyms CALPAIN4; CANP; CANPS; CAPN4; CDPS; CSS1
Note Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Sheep: 100%; Bovine: 100%; Rabbit: 100%; Dog: 93%; Horse: 93%; Mouse: 93%; Guinea pig: 93%
Reference Data
Protein Families Druggable Genome, Protease
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...