CDCA5 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-CDCA5 antibody: synthetic peptide directed towards the middle region of human CDCA5. Synthetic peptide located within the following region: ATPTSTPVPNPEAESSSKEGELDARDLEMSKKVRRSYSRLETLGSASTST
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	28 kDa
Gene Name	cell division cycle associated 5
Database Link	NP_542399 Entrez Gene 113130 Human UniProt ID Q96FF9
Background	CDCA5 is the regulator of sister chromatid cohesion in mitosis. It may act by regulating the ability of the cohesin complex to mediate sister chromatid cohesion, perhaps by altering the nature of the interaction of cohesin with the chromosomes.
Synonyms	SORORIN
Note	Immunogen Sequence Homology: Human: 100%
Reference Data
Protein Families	Druggable Genome

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.