Calreticulin (CALR) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-CALR antibody is: synthetic peptide directed towards the N-terminal region of Human CALR. Synthetic peptide located within the following region: SSGKFYGDEEKDKGLQTSQDARFYALSASFEPFSNKGQTLVVQFTVKHEQ
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	45 kDa
Gene Name	calreticulin
Database Link	NP_004334 Entrez Gene 811 Human UniProt ID P27797
Background	Calreticulin is a multifunctional protein that acts as a major Ca(2+)-binding (storage) protein in the lumen of the endoplasmic reticulum.
Synonyms	cC1qR; CRT; HEL-S-99n; RO; SSA
Note	Immunogen Sequence Homology: Pig: 100%; Human: 100%; Dog: 93%; Rat: 93%; Horse: 93%; Mouse: 93%; Bovine: 93%; Rabbit: 93%; Zebrafish: 93%; Guinea pig: 93%
Reference Data
Protein Families	Druggable Genome, Secreted Protein, Transcription Factors
Protein Pathways	Antigen processing and presentation

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.