MPRIP Rabbit Polyclonal Antibody
CAT#: TA344565
Rabbit Polyclonal Anti-MPRIP Antibody - middle region
Need it in bulk or conjugated?
Get a free quote
CNY 5,250.00
CNY 4,840.00
CNY 300.00
CNY 1,430.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Rat |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-Mprip antibody is: synthetic peptide directed towards the middle region of Rat Mprip. Synthetic peptide located within the following region: ATISAIEAMKNAHREEMERELEKSQRSQISSINSDIEALRRQYLEELQSV |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 113 kDa |
Gene Name | myosin phosphatase Rho interacting protein |
Database Link | |
Background | Mouse homolog binds F-actin and may play a role in F-actin bundling and cytoskeleton organization. |
Synonyms | M-RIP; MRIP; p116Rip; RHOIP3; RIP3 |
Note | Immunogen Sequence Homology: Human: 100%; Pig: 93%; Horse: 93%; Bovine: 93%; Dog: 86%; Rat: 86%; Mouse: 86%; Rabbit: 86%; Guinea pig: 86% |
Reference Data | |
Protein Families | Druggable Genome |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |