PDE8A Rabbit Polyclonal Antibody
CAT#: TA344622
Rabbit Polyclonal Anti-PDE8A Antibody - C-terminal region
Need it in bulk or conjugated?
Get a free quote
CNY 4,628.00
CNY 300.00
CNY 1,430.00
CNY 3,080.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-PDE8A antibody: synthetic peptide directed towards the C terminal of human PDE8A. Synthetic peptide located within the following region: VSNPCRPLQYCIEWAARISEEYFSQTDEEKQQGLPVVMPVFDRNTCSIPK |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 88 kDa |
Gene Name | phosphodiesterase 8A |
Database Link | |
Background | Phosphodiesterases (PDEs) regulate the intracellular levels of cAMP and cGMP. These cyclic nucleotides play an important role as second messengers in multiple physiologic processes, including regulation of vascular resistance, cardiac output, visceral motility, immune response, inflammation, neuroplasticity, vision, and reproduction. PDEs comprise a large superfamily of enzymes divided into 10 families. Different PDEs can be distinguished by their structure, tissue expression, localization, substrate specificity, regulation, and sensitivity to PDE inhibitors. Diversity in structure and specificity of function make PDEs promising targets for the pharmacotherapy of diseases modulated by cyclic nucleotide signaling (Hetman et al., MIM 2000). See MIM 171885. |
Synonyms | HsT19550 |
Note | Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Dog: 93%; Horse: 93%; Zebrafish: 92%; Guinea pig: 92% |
Reference Data | |
Protein Families | Druggable Genome |
Protein Pathways | Progesterone-mediated oocyte maturation, Purine metabolism |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |