TBCCD1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-TBCCD1 antibody: synthetic peptide directed towards the N terminal of human TBCCD1. Synthetic peptide located within the following region: WPSPRNKSQSPDLTEKSNCHNKNWNDYSHQAFVYDHLSDLLELLLDPKQL
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	63 kDa
Gene Name	TBCC domain containing 1
Database Link	NP_060608 Entrez Gene 55171 Human UniProt ID Q9NVR7
Background	The function of this protein remains unknown.
Synonyms	FLJ10560
Note	Immunogen Sequence Homology: Human: 100%; Horse: 92%; Dog: 85%; Pig: 85%; Rabbit: 79%; Guinea pig: 79%; Bovine: 77%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.