PINX1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-PINX1 antibody: synthetic peptide directed towards the middle region of human PINX1. Synthetic peptide located within the following region: EKKSFSLEEKSKISKNRVHYMKFTKGKDLSSRSKTDLDCIFGKRQSKKTP
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	37 kDa
Gene Name	PIN2/TERF1 interacting, telomerase inhibitor 1
Database Link	NP_060354 Entrez Gene 54984 Human UniProt ID Q96BK5
Background	PINX1 is a microtubule-binding protein essential for faithful chromosome segregation. PINX1 mediates TRF1 and TERT accumulation in nucleolus and enhances TRF1 binding to telomeres. PINX1 inhibits telomerase activity and may inhibit cell proliferation and act as tumor suppressor.
Synonyms	LPTL; LPTS
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 92%; Zebrafish: 86%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.