PNRC2 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Rat
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-Pnrc2 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: MGGGERYNIPDPQSRNASKNQQQHNRQKTKDQNSQMKIVHKKKERGHGYN
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	15 kDa
Gene Name	proline rich nuclear receptor coactivator 2
Database Link	NP_060231 Entrez Gene 100125373 Rat UniProt ID Q9NPJ4
Background	Pnrc2 is involved in nonsense-mediated mRNA decay (NMD) by acting as a bridge between the mRNA decapping complex and the NMD machinery. It may act by targeting the NMD machinery to the P-body and recruiting the decapping machinery to aberrant mRNAs. It is required for UPF1/RENT1 localization to the P-body.It also acts as a nuclear receptor coactivator. It may play a role in controlling the energy balance between energy storage and energy expenditure.
Synonyms	FLJ20312; MGC99541
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Rabbit: 100%; Rat: 93%; Mouse: 93%; Bovine: 93%; Guinea pig: 93%
Reference Data
Protein Families	Druggable Genome, Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.