MEMO1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-MEMO1 antibody: synthetic peptide directed towards the middle region of human MEMO1. Synthetic peptide located within the following region: AMESHKDEFTIIPVLVGALSESKEQEFGKLFSKYLADPSNLFVVSSDFCH
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	34 kDa
Gene Name	mediator of cell motility 1
Database Link	NP_057039 Entrez Gene 51072 Human UniProt ID Q9Y316
Background	MEMO1 may control cell migration by relaying extracellular chemotactic signals to the microtubule cytoskeleton. MEMO1 is the mediator of ERBB2 signaling. MEMO1 is required for breast carcinoma cell migration.
Synonyms	C2orf4; CGI-27; MEMO; NS5ATP7
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 86%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.