OVOL2 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB, IF
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-OVOL2 antibody: synthetic peptide directed towards the N terminal of human OVOL2. Synthetic peptide located within the following region: PKVFLVKRRSLGVSVRSWDELPDEKRADTYIPVGLGRLLHDPPEDCRSDG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	30 kDa
Gene Name	ovo like zinc finger 2
Database Link	NP_067043 Entrez Gene 58495 Human UniProt ID Q9BRP0
Background	OVOL2 contains 4 C2H2-type zinc fingers. It belongs to the krueppel C2H2-type zinc-finger protein family. It is a DNA-binding protein that binds to the 5'-G[GCT]GGGGG-3' core sequence. Probably acts as a transcription regulator.
Synonyms	EUROIMAGE566589; ZNF339
Note	Immunogen Sequence Homology: Dog: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Mouse: 93%
Reference Data
Protein Families	Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.