NIF1 (ZNF335) Rabbit Polyclonal Antibody

CAT#: TA345356

Rabbit Polyclonal Anti-ZNF335 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 4,628.00


货期*
2周

规格
    • 50 ug

Product images

经常一起买 (1)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1,430.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-ZNF335 antibody: synthetic peptide directed towards the middle region of human ZNF335. Synthetic peptide located within the following region: EAAAHSAVTAVADAAMAQAQGLFGTDETVPEHIQQLQHQGIEYDVITLAD
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 145 kDa
Gene Name zinc finger protein 335
Background ZNF335 enhances transcriptional activation by ligand-bound nuclear hormone receptors. However, it does this not by direct interaction with the receptor, but by direct interaction with the nuclear hormone receptor transcriptional coactivator NRC. ZNF335 may function by altering local chromatin structure.The protein encoded by this gene enhances transcriptional activation by ligand-bound nuclear hormone receptors. However, it does this not by direct interaction with the receptor, but by direct interaction with the nuclear hormone receptor transcriptional coactivator NRC. The encoded protein may function by altering local chromatin structure.
Synonyms MCPH10; NIF-1; NIF1; NIF2
Note Immunogen Sequence Homology: Human: 100%; Rabbit: 93%; Dog: 86%; Pig: 86%; Rat: 86%; Horse: 86%; Bovine: 86%; Guinea pig: 86%
Reference Data
Protein Families Druggable Genome, Nuclear Hormone Receptor, Transcription Factors
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...