TRIM14 Rabbit Polyclonal Antibody
CAT#: TA345475
Rabbit Polyclonal Anti-TRIM14 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 4,628.00
CNY 300.00
CNY 1,430.00
CNY 4,840.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-TRIM14 antibody: synthetic peptide directed towards the middle region of human TRIM14. Synthetic peptide located within the following region: LSFEPVKSFFKGLVEAVESTLQTPLDIRLSPTNHAYSALKVSSPRLVSNR |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 28 kDa |
Gene Name | tripartite motif containing 14 |
Database Link | |
Background | TRIM14 is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein localizes to cytoplasmic bodies and its function has not been de |
Synonyms | KIAA0129; OTTHUMP00000021761; OTTHUMP00000021762; OTTHUMP00000021763; OTTHUMP00000021764; tripartite motif-containing 14; tripartite motif protein 14; tripartite motif protein TRIM14 |
Note | Immunogen Sequence Homology: Human: 100% |
Reference Data | |
Protein Families | Druggable Genome |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |