ADAMTS19 Rabbit Polyclonal Antibody

CAT#: TA345497

Rabbit Polyclonal Anti-ADAMTS19 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 5,250.00


货期*
6周

规格
    • 100 ul

Product images

经常一起买 (2)
Transient overexpression lysate of ADAM metallopeptidase with thrombospondin type 1 motif, 19 (ADAMTS19)
    • 100 ug

CNY 4,840.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1,430.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-ADAMTS19 antibody: synthetic peptide directed towards the N terminal of human ADAMTS19. Synthetic peptide located within the following region: MRLTHICCCCLLYQLGFLSNGIVSELQFAPDREEWEVVFPALWRREPVDP
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 100 kDa
Gene Name ADAM metallopeptidase with thrombospondin type 1 motif 19
Background This gene encodes a member of the ADAMTS (a disintegrin and metalloproteinase with thrombospondin motif) protein family. Members of the family share several distinct protein modules, including a propeptide region, a metalloproteinase domain, a disintegrin-like domain, and a thrombospondin type 1 (TS) motif. Individual members of this family differ in the number of C-terminal TS motifs, and some have unique C-terminal domains. The protein encoded by this gene has high sequence similarity to the protein encoded by ADAMTS16, another family member.
Synonyms FLJ16042
Note Immunogen Sequence Homology: Dog: 100%; Human: 100%; Bovine: 86%; Rat: 77%
Reference Data
Protein Families Protease, Secreted Protein
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...