ZUP1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-C6orf113 antibody: synthetic peptide directed towards the C terminal of human C6orf113. Synthetic peptide located within the following region: LCLLILDPGCPSREMQKLLKQDIEASSLKQLRKSMGNLKHKQYQILAVEG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	66 kDa
Gene Name	zinc finger with UFM1 specific peptidase domain
Database Link	NP_659499 Entrez Gene 221302 Human UniProt ID Q96AP4
Background	The exact function of C6orf113 remains unknown.
Synonyms	C6orf113; dJ412I7.3
Note	Immunogen Sequence Homology: Human: 100%; Rabbit: 93%; Mouse: 92%; Dog: 86%; Pig: 86%; Rat: 86%; Horse: 86%; Bovine: 86%; Guinea pig: 86%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.