CCBL2 (KYAT3) Rabbit Polyclonal Antibody

CAT#: TA345720

Rabbit Polyclonal Anti-RP11-82K18.3 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 5,250.00


货期*
6周

规格
    • 100 ul

Product images

经常一起买 (5)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1,430.00


Recombinant protein of human cysteine conjugate-beta lyase 2 (CCBL2), transcript variant 1, 20 µg
    • 20 ug

CNY 2,900.00
CNY 6,650.00


Transient overexpression lysate of cysteine conjugate-beta lyase 2 (CCBL2), transcript variant 1
    • 100 ug

CNY 4,840.00


Recombinant protein of human cysteine conjugate-beta lyase 2 (CCBL2), transcript variant 2, 100 µg
    • 100 ug

CNY 9,998.00


Transient overexpression lysate of cysteine conjugate-beta lyase 2 (CCBL2), transcript variant 2
    • 100 ug

CNY 4,840.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-RP11-82K18.3 antibody: synthetic peptide directed towards the N terminal of human RP11-82K18.3. Synthetic peptide located within the following region: SGRAKFLKTISSSKILGFSTSAKMSLKFTNAKRIEGLDSNVWIEFTKLAA
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Protein A purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 46 kDa
Gene Name kynurenine aminotransferase 3
Background RP11-82K18.3 is an aminotransferase that transaminates kynurenine to form kynurenic acid. Kynurenic acid is a metabolite of tryptophan.
Synonyms CCBL2; KAT3; KATIII
Note Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 93%; Horse: 93%; Mouse: 93%; Bovine: 92%; Rat: 91%; Zebrafish: 91%; Rabbit: 86%; Guinea pig: 85%
Reference Data
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...