ISG20 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-ISG20 antibody: synthetic peptide directed towards the middle region of human ISG20. Synthetic peptide located within the following region: TSTDRLLWREAKLDHCRRVSLRVLSERLLHKSIQNSLLGHSSVEDARATM
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	20 kDa
Gene Name	interferon stimulated exonuclease gene 20kDa
Database Link	NP_002192 Entrez Gene 3669 Human UniProt ID Q96AZ6
Background	ISG20 belongs to the the exonuclease superfamily. It is exonuclease with specificity for single-stranded RNA and, to a lesser extent for DNA. It degrades RNA at a rate that is approximately 35-fold higher than its rate for single-stranded DNA. It is involved in the antiviral function of IFN against RNA viruses.
Synonyms	CD25; HEM45
Note	Immunogen Sequence Homology: Pig: 100%; Human: 100%; Rat: 92%; Horse: 86%; Rabbit: 86%; Dog: 85%; Guinea pig: 85%; Bovine: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.