SRP14 Rabbit Polyclonal Antibody

CAT#: TA345831

Rabbit Polyclonal Anti-SRP14 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 5,250.00


货期*
6周

规格
    • 100 ug

Product images

经常一起买 (4)
Transient overexpression lysate of signal recognition particle 14kDa (homologous Alu RNA binding protein) (SRP14)
    • 100 ug

CNY 3,080.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1,430.00


Recombinant protein of human signal recognition particle 14kDa (homologous Alu RNA binding protein) (SRP14), 20 µg
    • 20 ug

CNY 2,900.00
CNY 6,650.00


Recombinant protein of human signal recognition particle 14kDa (homologous Alu RNA binding protein) (SRP14), 100 µg
    • 100 ug

CNY 9,998.00

Specifications

Product Data
Applications IHC, WB
Recommend Dilution WB, IHC
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-SRP14 antibody: synthetic peptide directed towards the N terminal of human SRP14. Synthetic peptide located within the following region: KPIPKKGTVEGFEPADNKCLLRATDGKKKISTVVSSKEVNKFQMAYSNLL
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Protein A purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 15 kDa
Gene Name signal recognition particle 14kDa
Background SRP14 belongs to the SRP14 family. The signal-recognition-particle assembly has a crucial role in targeting secretory proteins to the rough endoplasmic reticulum membrane. SRP9 together with SRP14 and the Alu portion of the SRP RNA, constitutes the elongation arrest domain of SRP. The complex of SRP9 and SRP14 is required for SRP RNA binding.
Synonyms ALURBP
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Sheep: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Mouse: 93%; Zebrafish: 86%
Reference Data
Protein Pathways Protein export
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...