APOBEC2 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	IHC, WB
Recommend Dilution	WB, IHC
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-APOBEC2 antibody: synthetic peptide directed towards the N terminal of human APOBEC2. Synthetic peptide located within the following region: VATEAASQNGEDLENLDDPEKLKELIELPPFEIVTGERLPANFFKFQFRN
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Protein A purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	25 kDa
Gene Name	apolipoprotein B mRNA editing enzyme catalytic subunit 2
Database Link	NP_006780 Entrez Gene 10930 Human UniProt ID Q9Y235
Background	APOBEC2 belongs to the cytidine and deoxycytidylate deaminase family. It is probable C to U editing enzyme whose physiological substrate is not yet known. It does not display detectable apoB mRNA editing and has a low intrinsic cytidine deaminase activity.
Synonyms	ARCD1; ARP1
Note	Immunogen Sequence Homology: Dog: 100%; Human: 100%; Horse: 93%; Bovine: 93%; Rabbit: 93%; Pig: 90%; Rat: 90%; Guinea pig: 90%; Mouse: 86%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.