CDC25B Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-Cdc25b antibody is synthetic peptide directed towards the middle region of Mouse Cdc25b. Synthetic peptide located within the following region: KEEEQDLIMFSKCQRLFRSPSMPCSVIRPILKRLERPQDRDVPVQSKRRK
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	65 kDa
Gene Name	cell division cycle 25B
Database Link	NP_068659 Entrez Gene 12531 Mouse UniProt ID P30305
Background	Tyrosine protein phosphatase which functions as a dosage-dependent inducer of mitotic progression. It is required for G2/M phases of the cell cycle progression and abscission during cytokinesis in a ECT2-dependent manner and directly dephosphorylates CDK1 and stimulates its kinase activity.
Synonyms	cell division cycle 25 homolog B (S. pombe); cell division cycle 25B; OTTHUMP00000030137; OTTHUMP00000030138; OTTHUMP00000030139
Note	Immunogen Sequence Homology: Human: 100%; Bovine: 93%; Rat: 86%; Horse: 86%; Mouse: 86%; Dog: 79%; Pig: 79%; Guinea pig: 79%
Reference Data
Protein Families	Druggable Genome, Phosphatase
Protein Pathways	Cell cycle, MAPK signaling pathway, Progesterone-mediated oocyte maturation

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.