CEACAM6 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	IHC, WB
Recommend Dilution	WB, IHC
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-CEACAM6 antibody: synthetic peptide directed towards the middle region of human CEACAM6. Synthetic peptide located within the following region: EIQNPASANRSDPVTLNVLYGPDGPTISPSKANYRPGENLNLSCHAASNP
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	38 kDa
Gene Name	carcinoembryonic antigen related cell adhesion molecule 6
Database Link	NP_002474 Entrez Gene 4680 Human UniProt ID P40199
Background	Many breast, pancreatic, colonic and non-small-cell lung carcinoma lines express CEACAM6 and CEACAM5, and antibodies to both can affect tumor cell growth in vitro and in vivo. CEACAM6 expression is elevated in many solid tumors, but variable as a function of histotype. It may be a promising target for antibody-based therapy.
Synonyms	CD66c; CEAL; NCA
Note	Immunogen Sequence Homology: Human: 100%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.