Surfactant protein D (SFTPD) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-SFTPD antibody: synthetic peptide directed towards the middle region of human SFTPD. Synthetic peptide located within the following region: PPGPPGVPGPAGREGPLGKQGNIGPQGKPGPKGEAGPKGEVGAPGMQGSA
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	35 kDa
Gene Name	surfactant protein D
Database Link	NP_003010 Entrez Gene 6441 Human UniProt ID P35247
Background	SFTPD contributes to the lung's defense against inhaled microorganisms. SFTPD may participate in the extracellular reorganization or turnover of pulmonary surfactant.
Synonyms	COLEC7; PSP-D; SFTP4; SP-D
Note	Immunogen Sequence Homology: Human: 100%; Rat: 92%; Mouse: 92%; Rabbit: 86%; Pig: 85%; Guinea pig: 85%; Dog: 79%
Reference Data
Protein Families	Druggable Genome, Secreted Protein

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.