PPPDE1 (DESI2) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-DESI2 antibody is: synthetic peptide directed towards the C-terminal region of Human DESI2. Synthetic peptide located within the following region: SCLPKEWLTPAALQSSVSQELQDELEEAEDAAASASVASTAAGSRPGRHT
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	21 kDa
Gene Name	desumoylating isopeptidase 2
Database Link	NP_057160 Entrez Gene 51029 Human UniProt ID Q9BSY9
Background	DESI2 is a protease which may deconjugate SUMO from some substrate proteins.
Synonyms	C1orf121; CGI-146; DESI; DeSI-2; DESI1; FAM152A; PNAS-4; PPPDE1
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 93%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.