Protein C (PROC) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-PROC antibody: synthetic peptide directed towards the middle region of human PROC. Synthetic peptide located within the following region: PCGRPWKRMEKKRSHLKRDTEDQEDQVDPRLIDGKMTRRGDSPWQVVLLD
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	52 kDa
Gene Name	protein C, inactivator of coagulation factors Va and VIIIa
Database Link	NP_000303 Entrez Gene 5624 Human UniProt ID P04070
Background	Protein C is a vitamin K-dependent serine protease that regulates blood coagulation by inactivating factors Va and VIIIa in the presence of calcium ions and phospholipids.
Synonyms	APC; PC; PROC1; THPH3; THPH4
Note	Immunogen Sequence Homology: Human: 100%; Horse: 79%
Reference Data
Protein Families	Druggable Genome, Protease
Protein Pathways	Complement and coagulation cascades

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.