Steroid sulfatase (STS) Rabbit Polyclonal Antibody

CAT#: TA346177

Rabbit Polyclonal Anti-STS Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 5,250.00


货期*
6周

规格
    • 100 ul

Cited in 1 publication.

Product images

经常一起买 (4)
Transient overexpression lysate of steroid sulfatase (microsomal), isozyme S (STS)
    • 100 ug

CNY 3,080.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1,430.00


Recombinant protein of human steroid sulfatase (microsomal), isozyme S (STS), 20 µg
    • 20 ug

CNY 2,900.00
CNY 6,650.00


Recombinant protein of human steroid sulfatase (microsomal), isozyme S (STS), 100 µg
    • 100 ug

CNY 9,998.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-STS antibody: synthetic peptide directed towards the middle region of human STS. Synthetic peptide located within the following region: EPTSNMDIFPTVAKLAGAPLPEDRIIDGRDLMPLLEGKSQRSDHEFLFHY
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 63 kDa
Gene Name steroid sulfatase (microsomal), isozyme S
Background STS catalyzes the conversion of sulfated steroid precursors to estrogens during pregnancy. The protein is found in the endoplasmic reticulum, where it acts as a homodimer. Mutations in its gene are known to cause X-linked ichthyosis The protein encoded by this gene catalyzes the conversion of sulfated steroid precursors to estrogens during pregnancy. The encoded protein is found in the endoplasmic reticulum, where it acts as a homodimer. Mutations in this gene are known to cause X-linked ichthyosis (XLI). Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Synonyms ARSC; ARSC1; ASC; ES; SSDD; XLI
Note Immunogen Sequence Homology: Human: 100%; Horse: 93%; Pig: 92%; Bovine: 90%; Zebrafish: 89%; Guinea pig: 86%; Dog: 80%; Mouse: 77%; Rabbit: 77%
Reference Data
Protein Families Druggable Genome, Transmembrane
Protein Pathways Androgen and estrogen metabolism
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)

Customer Reviews 
Loading...