Kallikrein 2 (KLK2) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-KLK2 antibody: synthetic peptide directed towards the middle region of human KLK2. Synthetic peptide located within the following region: KHQSLRPDEDSSHDLMLLRLSEPAKITDVVKVLGLPTQEPALGTTCYASG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	25 kDa
Gene Name	kallikrein related peptidase 2
Database Link	NP_001002231 Entrez Gene 3817 Human UniProt ID P20151
Background	Glandular kallikreins cleave Met-Lys and Arg-Ser bonds in kininogen to release Lys-bradykinin.
Synonyms	hGK-1; hK2; KLK2A2
Note	Immunogen Sequence Homology: Human: 100%; Rat: 93%; Mouse: 86%; Pig: 79%; Dog: 77%
Reference Data
Protein Families	Druggable Genome, Protease

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.