GNAZ Rabbit Polyclonal Antibody
CNY 4,628.00
CNY 3,080.00
CNY 300.00
CNY 1,430.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-GNAZ antibody: synthetic peptide directed towards the N terminal of human GNAZ. Synthetic peptide located within the following region: LIIYNAIDSLTRIIRALAALRIDFHNPDRAYDAVQLFALTGPAESKGEIT |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 39 kDa |
Gene Name | G protein subunit alpha z |
Database Link | |
Background | GNAZ is a member of a G protein subfamily that mediates signal transduction in pertussis toxin-insensitive systms. This protein may play a role in maintaining the ionic balance of perilymphatic and endolymphatic cochlear fluids.The protein encoded by this gene is a member of a G protein subfamily that mediates signal transduction in pertussis toxin-insensitive systms. This encoded protein may play a role in maintaining the ionic balance of perilymphatic and endolymphatic cochlear fluids. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. |
Synonyms | alpha z polypeptide; guanine nucleotide binding protein; guanine nucleotide binding protein (G protein); transducin alpha |
Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100% |
Reference Data | |
Protein Families | Druggable Genome |
Protein Pathways | Long-term depression |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |