PF4V1 Rabbit Polyclonal Antibody
CAT#: TA346326
Rabbit Polyclonal Anti-PF4V1 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5,250.00
CNY 300.00
CNY 1,430.00
CNY 2,900.00
CNY 6,650.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-PF4V1 antibody: synthetic peptide directed towards the middle region of human PF4V1. Synthetic peptide located within the following region: RPRHITSLEVIKAGPHCPTAQLIATLKNGRKICLDLQALLYKKIIKEHLE |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 11 kDa |
Gene Name | platelet factor 4 variant 1 |
Database Link | |
Background | PF4V1 is the inhibitor of angiogenesis. PF4V1 is the inhibitor of endothelial cell chemotaxis (in vitro). |
Synonyms | CXCL4L1; CXCL4V1; PF4-ALT; PF4A; SCYB4V1 |
Note | Immunogen Sequence Homology: Human: 100%; Pig: 85% |
Reference Data | |
Protein Families | Secreted Protein |
Protein Pathways | Chemokine signaling pathway, Cytokine-cytokine receptor interaction |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |