Glycerol 3 Phosphate Dehydrogenase (GPD1) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-GPD1 antibody: synthetic peptide directed towards the middle region of human GPD1. Synthetic peptide located within the following region: TFLESCGVADLITTCYGGRNRKVAEAFARTGKSIEQLEKELLNGQKLQGP
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	37 kDa
Gene Name	glycerol-3-phosphate dehydrogenase 1
Database Link	NP_005267 Entrez Gene 2819 Human UniProt ID P21695
Background	GPD1L belongs to the NAD-dependent glycerol-3-phosphate dehydrogenase family. Defects in GPD1L are the cause of Brugada syndrome type 2 (BRS2) and sudden infant death syndrome (SIDS).
Synonyms	GPD-C; GPDH-C; HTGTI
Note	Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Horse: 93%; Mouse: 93%; Yeast: 93%; Bovine: 93%; Rabbit: 93%; Guinea pig: 93%
Reference Data
Protein Pathways	Glycerophospholipid metabolism

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.