Lgals4 Rabbit Polyclonal Antibody
CAT#: TA346427
Rabbit Polyclonal Anti-Lgals4 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 4,628.00
CNY 300.00
CNY 1,430.00
CNY 7,106.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Mouse |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-Lgals4 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: VGSSGDIALHLNPRIGDSVVRNSFMNGSWGAEERKVAYNPFGPGQFFDLS |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 36 kDa |
Gene Name | lectin, galactose binding, soluble 4 |
Database Link | |
Background | Lgals4 binds lactose and a related range of sugars. |
Synonyms | GAL4; galectin-4; L36LBP |
Note | Immunogen Sequence Homology: Human: 100%; Pig: 93%; Mouse: 93%; Bovine: 93%; Rabbit: 93%; Zebrafish: 92%; Rat: 90%; Dog: 86%; Horse: 86%; Guinea pig: 79% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |