Lgals4 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-Lgals4 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: VGSSGDIALHLNPRIGDSVVRNSFMNGSWGAEERKVAYNPFGPGQFFDLS
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	36 kDa
Gene Name	lectin, galactose binding, soluble 4
Database Link	NP_034836 Entrez Gene 16855 Mouse UniProt ID Q8K419
Background	Lgals4 binds lactose and a related range of sugars.
Synonyms	GAL4; galectin-4; L36LBP
Note	Immunogen Sequence Homology: Human: 100%; Pig: 93%; Mouse: 93%; Bovine: 93%; Rabbit: 93%; Zebrafish: 92%; Rat: 90%; Dog: 86%; Horse: 86%; Guinea pig: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.