CEMIP2 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-TMEM2 antibody: synthetic peptide directed towards the middle region of human TMEM2. Synthetic peptide located within the following region: MLTGLCQGCGTRQVVFTSDPHKSYLPVQFQSPDKAETQRGDPSVISVNGT
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	154 kDa
Gene Name	transmembrane protein 2
Database Link	NP_037522 Entrez Gene 23670 Human UniProt ID Q9UHN6
Background	The function of this protein remains unknown.
Synonyms	OTTHUMP00000021450; transmembrane protein 2
Note	Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Rabbit: 100%; Dog: 93%; Horse: 93%; Mouse: 93%; Guinea pig: 93%; Bovine: 86%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.