Atp5c1 Rabbit Polyclonal Antibody

CAT#: TA346598

Rabbit Polyclonal Anti-Atp5c1 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 5,250.00


货期*
6周

规格
    • 100 ul

Product images

经常一起买 (1)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1,430.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Mouse
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for Anti-Atp5c1 antibody is: synthetic peptide directed towards the N-terminal region of Mouse Atp5c1. Synthetic peptide located within the following region: VRNMATLKDITRRLKSIKNIQKITKSMKMVAAAKYARAERELKPARVYGT
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 30 kDa
Gene Name ATP synthase, H+ transporting, mitochondrial F1 complex, gamma polypeptide 1
Background Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core, and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F(1) domain and the central stalk which is part of the complex rotary element. The gamma subunit protrudes into the catalytic domain formed of alpha(3)beta(3). Rotation of the central stalk against the surrounding alpha(3)beta(3) subunits leads to hydrolysis of ATP in three separate catalytic sites on the beta subunits.
Synonyms ATP5C; ATP5CL1
Note Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Dog: 93%; Horse: 93%; Zebrafish: 93%
Reference Data
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...