RABL4 (IFT27) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	IHC, WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-RABL4 antibody: synthetic peptide directed towards the C terminal of human RABL4. Synthetic peptide located within the following region: RAWALGQGLECFETSVKEMENFEAPFHCLAKQFHQLYREKVEVFRALA
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	20 kDa
Gene Name	intraflagellar transport 27
Database Link	NP_006851 Entrez Gene 11020 Human UniProt ID Q9BW83
Background	This gene encodes a GTP-binding protein that is a core component of the intraflagellar transport complex B. Characterization of the similar Chlamydomonas protein indicates a function in cell cycle control. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq, Jan 2012]
Synonyms	BBS19; RABL4; RAYL
Note	Immunogen Sequence Homology: Human: 100%; Dog: 93%; Sheep: 86%; Bovine: 86%; Pig: 85%; Rat: 79%; Mouse: 79%
Reference Data
Protein Families	Druggable Genome

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.