Cblif Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-Gif antibody is: synthetic peptide directed towards the C-terminal region of Mouse Gif. Synthetic peptide located within the following region: LIVSSINNIAENVNHKTYWEFLSGKTPLDEGVAYYIPFNHEHITANFTQY
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	45 kDa
Gene Name	gastric intrinsic factor
Database Link	NP_032144 Entrez Gene 14603 Mouse UniProt ID P52787
Background	Promotes absorption of the essential vitamin cobalamin (Cbl) in the ileum. After interaction with CUBN, the GIF-cobalamin complex is internalized via receptor-mediated endocytosis.
Synonyms	IF; IFMH; INF; TCN3
Note	Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 93%; Guinea pig: 93%; Dog: 92%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.