Stk25 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Rat
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-Stk25 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: TKKTSFLTELIDRYKRWKSEGHGEESSSEDSDIDGEAEDGEQGPIWTFPP
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	48 kDa
Gene Name	serine/threonine kinase 25
Database Link	NP_908938 Entrez Gene 373542 Rat
Background	human homolog is a member of the Ste20-like kinase family which is activated by cellular, particularly oxidant, stress but which does not activate either of the stress-activated MAP kinase cascades (p38 and SAPKs) [RGD, Feb 2006]. ##Evidence-Data-START## Transcript exon combination :: AY346152.1, BC087092.1 [ECO:0000332] RNAseq introns :: mixed/partial sample support ERS160522, ERS160537 [ECO:0000350] ##Evidence-Data-END##
Synonyms	DKFZp686J1430; OTTHUMP00000200205; SOK-1; SOK1; YSK1
Note	Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 100%; Pig: 93%; Horse: 93%; Guinea pig: 93%; Dog: 86%; Bovine: 86%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.