AGXT2 Rabbit Polyclonal Antibody

CAT#: TA346847

Rabbit Polyclonal Anti-AGXT2 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 5,250.00


货期*
6周

规格
    • 100 ul

Product images

经常一起买 (4)
Transient overexpression lysate of alanine-glyoxylate aminotransferase 2 (AGXT2), nuclear gene encoding mitochondrial protein
    • 100 ug

CNY 4,840.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1,430.00


Recombinant protein of human alanine-glyoxylate aminotransferase 2 (AGXT2), nuclear gene encoding mitochondrial protein, 20 µg
    • 20 ug

CNY 2,900.00
CNY 6,650.00


Recombinant protein of human alanine-glyoxylate aminotransferase 2 (AGXT2), nuclear gene encoding mitochondrial protein, 100 µg
    • 100 ug

CNY 9,998.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-AGXT2 antibody: synthetic peptide directed towards the N terminal of human AGXT2. Synthetic peptide located within the following region: TSVTKLSLHTKPRMPPCDFMPERYQSLGYNRVLEIHKEHLSPVVTAYFQK
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 52 kDa
Gene Name alanine--glyoxylate aminotransferase 2
Background The protein encoded by this gene is a class III pyridoxal-phosphate-dependent mitochondrial aminotransferase. It catalyzes the conversion of glyoxylate to glycine using L-alanine as the amino donor. [provided by RefSeq, Dec 2008]
Synonyms AGT2; DAIBAT
Note Immunogen Sequence Homology: Human: 100%; Bovine: 86%; Dog: 79%; Rat: 79%; Horse: 79%; Rabbit: 79%; Mouse: 77%
Reference Data
Protein Families Druggable Genome
Protein Pathways Alanine, aspartate and glutamate metabolism
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...