GCSH Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	IHC
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen is a synthetic peptide directed towards the following sequence IGTVGISNFAQEALGDVVYCSLPEVGTKLNKQDEFGALESVKAASELYSP
Specificity	Expected reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat Homology: Cow: 93%; Dog: 100%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 86%; Rabbit: 93%; Rat: 100%
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	For short term use, store at 2-8°C up to 1 week. For long term storage, store at -20°C in small aliquots to prevent freeze-thaw cycles.
Predicted Protein Size	19 kDa
Gene Name	glycine cleavage system protein H
Database Link	NP_004474 Entrez Gene 2653 Human UniProt ID P23434
Background	Degradation of glycine is brought about by the glycine cleavage system, which is composed of four mitochondrial protein components: P protein (a pyridoxal phosphate-dependent glycine decarboxylase), H protein (a lipoic acid-containing protein), T protein (a tetrahydrofolate-requiring enzyme), and L protein (a lipoamide dehydrogenase). The protein encoded by this gene is the H protein, which transfers the methylamine group of glycine from the P protein to the T protein. Defects in this gene are a cause of nonketotic hyperglycinemia (NKH). Two transcript variants, one protein-coding and the other probably not protein-coding,have been found for this gene. Also, several transcribed and non-transcribed pseudogenes of this gene exist throughout the genome.
Synonyms	GCE; NKH
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.