Gtf2a2 (BC048705) Mouse Tagged ORF Clone

CAT#: MG200471

  • TrueORF®

Gtf2a2 (tGFP-tagged) - Mouse general transcription factor II A, 2 (cDNA clone MGC:59444 IMAGE:6505667)

ORF Plasmid: DDK tGFP



  "BC048705" in other vectors (4)

Need custom modification / cloning service?
Get a free quote

Mouse Protein / Lysate Request

CNY 2,850.00


货期*
4周

规格
    • 10 ug

Product images

经常一起买 (4)
pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
    • 10 ug

CNY 6,080.00


Mouse monoclonal turboGFP antibody, clone OTI2H8
    • 100 ul

CNY 1,000.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

CNY 1,280.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

CNY 480.00

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag TurboGFP
Synonyms 12kDa, TfIIg
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MG200471 representing BC048705
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCTATCAGTTATACAGAAATACAACTTTGGGGAACAGTCTTCAAGAGAGCCTTGATGAGCTCATAC
AGTCTCAACAGATCACCCCCCAGCTTGCGCTTCAAGTTCTACTTCAGTTTGATAAAGCTATAAATTCAGC
ATTGGCTCAGAGAGTCAGGAACAGAGTCAATTTCAGGGTAAGGATGTCTTCCTGCATCTGGAAGTCTGTA
CTGCTAACTCTGAGAGCGTACGTGGACTTAACTCACCATAGCAAGATTTGGTTAGTCTGGTTTGGGAACT
TGTTCTATAATCGTTGTGCTAAGTTCATCCATTCCATGTGTTTCAGAATTGCTTTTAGATTT


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>MG200471 representing BC048705
Red=Cloning site Green=Tags(s)

MAYQLYRNTTLGNSLQESLDELIQSQQITPQLALQVLLQFDKAINSALAQRVRNRVNFRVRMSSCIWKSV
LLTLRAYVDLTHHSKIWLVWFGNLFYNRCAKFIHSMCFRIAFRF

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN BC048705
ORF Size 344 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Reference Data
RefSeq BC048705, AAH48705
RefSeq Size 1124 bp
RefSeq ORF 344 bp
Locus ID 235459
Gene Summary TFIIA is a component of the transcription machinery of RNA polymerase II and plays an important role in transcriptional activation. TFIIA in a complex with TBP mediates transcriptional activity (By similarity).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Other Versions

Customer Reviews 
Loading...