Mal (NM_010762) Mouse Tagged ORF Clone

CAT#: MG201113

  • TrueORF®

Mal (tGFP-tagged) - Mouse myelin and lymphocyte protein, T-cell differentiation protein (Mal)

ORF Plasmid: DDK tGFP



  "NM_010762" in other vectors (4)

Need custom modification / cloning service?
Get a free quote

Mouse Protein / Lysate Request

CNY 2,850.00


货期*
3周

规格
    • 10 ug

Product images

经常一起买 (4)
pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
    • 10 ug

CNY 6,080.00


Mouse monoclonal turboGFP antibody, clone OTI2H8
    • 100 ul

CNY 1,000.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

CNY 1,280.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

CNY 480.00

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag TurboGFP
Synonyms Mpv17; VI; Vip17
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MG201113 representing NM_010762
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCTCCGGCAGCGGCTTCGGGTGGCAGCACCCTGCCCAGTGGCTTCTCGGTCTTCACCACCTTCCCTG
ACTTGCTCTTCGTTTGTGAGTTTGTCTTTGGAGGCCTGGTGTGGATCCTGATTGCCTCCTCCCTGGTACC
CTTGCCCCTGGCCCAGGGCTGGGTGATGTTTGTGTCTGTGTTCTGCTTTGTGGCCACCACTTCCCTGATG
ATCTTGTACATAATTGGTACTCATGGCGGTGAGACTTCCTGGATCACACTGGATGCAGCCTACCACTGTG
TGGCTGCCCTATTTTACCTCAGTGCCTCAGTTCTGGAAGCCCTGGCCACCATCTCAATGTTTGATGGCTT
TACTTACAAGCATTACCATGAAAACATCGCCGCAGTGGTGTTTGCCTACGTGGTCACTCTGATCTACGTG
GTCCATGCTGTGTTTTCCTTAATCAGATGGAAGTCTTCA


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>MG201113 representing NM_010762
Red=Cloning site Green=Tags(s)

MAPAAASGGSTLPSGFSVFTTFPDLLFVCEFVFGGLVWILIASSLVPLPLAQGWVMFVSVFCFVATTSLM
ILYIIGTHGGETSWITLDAAYHCVAALFYLSASVLEALATISMFDGFTYKHYHENIAAVVFAYVVTLIYV
VHAVFSLIRWKSS

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_010762
ORF Size 459 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_010762.5
RefSeq Size 2775 bp
RefSeq ORF 462 bp
Locus ID 17153
UniProt ID O09198
Gene Summary This gene encodes a highly hydrophobic integral membrane protein belonging to the MAL family of proteolipids. The encoded protein has been localized to the endoplasmic reticulum of T-cells and is a candidate linker protein in T-cell signal transduction. In addition, this proteolipid is localized in compact myelin of cells in the nervous system and has been implicated in myelin biogenesis and/or function. The protein plays a role in the formation, stabilization and maintenance of glycosphingolipid-enriched membrane microdomains. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2010]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Other Versions

Customer Reviews 
Loading...