Il1rn (BC042532) Mouse Tagged ORF Clone

CAT#: MG201227

  • TrueORF®

Il1rn (tGFP-tagged) - Mouse interleukin 1 receptor antagonist (cDNA clone MGC:35609 IMAGE:4486098)



Need custom modification / cloning service?
Get a free quote

Mouse Protein / Lysate Request

CNY 4,370.00


货期*
4周

规格
    • 10 ug

Product images

经常一起买 (4)
pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
    • 10 ug

CNY 6,080.00


Mouse monoclonal turboGFP antibody, clone OTI2H8
    • 100 ul

CNY 1,000.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

CNY 480.00


IL1RN Rabbit pAb
    • 100 ul

CNY 2,640.00

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag TurboGFP
Synonyms F630041P17Rik; IL-1ra
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MG201227 representing BC042532
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCTTCAGAGGCAGCCTGCCGCCCTTCTGGGAAAAGACCCTGCAAGATGCAAGCCTTCAGAATCTGGG
ATACTAACCAGAAGACCTTTTACCTGAGAAACAACCAGCTCATTGCTGGGTACTTACAAGGACCAAATAT
CAAACTAGAAGAAAAGTTAGACATGGTGCCTATTGACCTTCATAGTGTGTTCTTGGGCATCCACGGGGGC
AAGCTGTGCCTGTCTTGTGCCAAGTCTGGAGATGATATCAAGCTCCAGCTGGAGGAAGTTAACATCACTG
ATCTGAGCAAGAACAAAGAAGAAGACAAGCGCTTTACCTTCATCCGCTCTGAGAAAGGCCCCACCACCAG
CTTTGAGTCAGCTGCCTGTCCAGGATGGTTCCTCTGCACAACACTAGAGGCTGACCGTCCTGTGAGCCTC
ACCAACACACCGGAAGAGCCCCTTATAGTCACGAAGTTCTACTTCCAGGAAGACCAA


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>MG201227 representing BC042532
Red=Cloning site Green=Tags(s)

MASEAACRPSGKRPCKMQAFRIWDTNQKTFYLRNNQLIAGYLQGPNIKLEEKLDMVPIDLHSVFLGIHGG
KLCLSCAKSGDDIKLQLEEVNITDLSKNKEEDKRFTFIRSEKGPTTSFESAACPGWFLCTTLEADRPVSL
TNTPEEPLIVTKFYFQEDQ

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN BC042532
ORF Size 479 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Reference Data
RefSeq BC042532, AAH42532
RefSeq Size 2470 bp
RefSeq ORF 479 bp
Locus ID 16181
Gene Summary Inhibits the activity of interleukin-1 by binding to receptor IL1R1 and preventing its association with the coreceptor IL1RAP for signaling. Has no interleukin-1 like activity.[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...