Hsd17b12 (BC037620) Mouse Tagged ORF Clone

CAT#: MG201559

  • TrueORF®

Hsd17b12 (tGFP-tagged) - Mouse hydroxysteroid (17-beta) dehydrogenase 12 (cDNA clone MGC:46848 IMAGE:5375831)

ORF Plasmid: DDK tGFP



  "BC037620" in other vectors (4)

Need custom modification / cloning service?
Get a free quote

Mouse Protein / Lysate Request

CNY 4,370.00


货期*
4周

规格
    • 10 ug

Product images

经常一起买 (3)
pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
    • 10 ug

CNY 6,080.00


Mouse monoclonal turboGFP antibody, clone OTI2H8
    • 100 ul

CNY 1,000.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

CNY 480.00

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag TurboGFP
Synonyms KIK-I, Kik1
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MG201559 representing BC037620
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCATACGAGTATCCGGAATACTTTCTGGAAATTCCCGACTTGGACAACACCATCAAGAAACTGATAA
ATATTAATGTGCTTTCCGTTTGCAAGGTGACACGCTTGGTGCTGCCTGGCATGGTAGAAAGATCTAAAGG
GGTGATTCTCAACATCTCCTCAGCCAGTGGCATGCTCCCAGTTCCATTGTTGACAATCTACTCTGCAACC
AAGGCCTTTGTAGATTTCTTCTCTCAGTGCCTCCATGAGGAGTATAAGAGCAAGGGCATCTTTGTGCAGA
GTGTCATGCCATACCTTGTAGCTACAAAACTGGCAAAAATACAGAAGCCGACTTTGGATAAGCCCTCTGC
AGAGACATTTGTGAAGTCTGCAATTAAAACAGTAGGTTTGCAGACCCGAACCACTGGATATGTGATCCAC
TCTCTCATGGGCTCAATAAACTCAATCATGCCTCGTTGGATGTATTTTAAAATAATCATGGGTTTCAGCA
AGTCTTTGCGGAATCGCTACCTGAAGAAAAGGAAGAAGAAC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>MG201559 representing BC037620
Red=Cloning site Green=Tags(s)

MSYEYPEYFLEIPDLDNTIKKLININVLSVCKVTRLVLPGMVERSKGVILNISSASGMLPVPLLTIYSAT
KAFVDFFSQCLHEEYKSKGIFVQSVMPYLVATKLAKIQKPTLDKPSAETFVKSAIKTVGLQTRTTGYVIH
SLMGSINSIMPRWMYFKIIMGFSKSLRNRYLKKRKKN

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN BC037620
ORF Size 531 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Reference Data
RefSeq BC037620, AAH37620
RefSeq Size 1808 bp
RefSeq ORF 533 bp
Locus ID 56348
Gene Summary Catalyzes the second of the four reactions of the long-chain fatty acids elongation cycle. This endoplasmic reticulum-bound enzymatic process, allows the addition of two carbons to the chain of long- and very long-chain fatty acids/VLCFAs per cycle. This enzyme has a 3-ketoacyl-CoA reductase activity, reducing 3-ketoacyl-CoA to 3-hydroxyacyl-CoA, within each cycle of fatty acid elongation. Thereby, it may participate in the production of VLCFAs of different chain lengths that are involved in multiple biological processes as precursors of membrane lipids and lipid mediators. May also catalyze the transformation of estrone (E1) into estradiol (E2) and play a role in estrogen formation.[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Other Versions

Customer Reviews 
Loading...