Rab31 (NM_133685) Mouse Tagged ORF Clone

CAT#: MG218479

  • TrueORF®

Rab31 (tGFP-tagged) - Mouse RAB31 member RAS oncogene family (Rab31), (10ug)

ORF Plasmid: DDK tGFP



  "NM_133685" in other vectors (4)

Need custom modification / cloning service?
Get a free quote

Mouse Protein / Lysate Request

CNY 2,850.00


货期*
4周

规格
    • 10 ug

Product images

经常一起买 (4)
pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
    • 10 ug

CNY 6,080.00


Mouse monoclonal turboGFP antibody, clone OTI2H8
    • 100 ul

CNY 1,000.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

CNY 1,280.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

CNY 480.00

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag TurboGFP
Synonyms 1700093E07Rik; AI415285; Rab22B
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MG218479 representing NM_133685
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGATACGGGAGCTCAAAGTGTGTCTTCTCGGGGACACGGGGGTTGGGAAATCCAGCATTGTGTGTC
GTTTTGTCCAGGATCACTTTGACCACAACATCAGCCCCACTATTGGGGCATCTTTCATGACCAAAACCGT
GCCTTGTGGAAATGAACTTCACAAATTCCTCATCTGGGACACCGCTGGCCAGGAGCGGTTCCACTCCCTG
GCTCCTATGTACTACCGAGGATCTGCTGCAGCCGTCATCGTCTATGACATCACTAAGCAGGATTCATTTC
ATACCTTGAAAAAATGGGTCAAGGAGCTGAAGGAGCACGGCCCAGAAAACATTGTGATGGCGATTGCTGG
GAACAAGTGTGACCTCTCTGATATTAGGGAGGTGCCCCTGAAGGACGCTAAGGAGTACGCTGAATCCATA
GGTGCCATCGTGGTGGAGACCAGCGCGAAGAATGCCATTAACATCGAGGAGCTCTTTCAAGGAATCAGCC
GCCAGATCCCACCCTTGGGCCCTCAGGAAAATGGAAACAGCGGCGGGATCAAGCTTGGGAATCAGAGCTT
GCAAGCCAGCCGTCGGTGCTGC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>MG218479 representing NM_133685
Red=Cloning site Green=Tags(s)

MAIRELKVCLLGDTGVGKSSIVCRFVQDHFDHNISPTIGASFMTKTVPCGNELHKFLIWDTAGQERFHSL
APMYYRGSAAAVIVYDITKQDSFHTLKKWVKELKEHGPENIVMAIAGNKCDLSDIREVPLKDAKEYAESI
GAIVVETSAKNAINIEELFQGISRQIPPLGPQENGNSGGIKLGNQSLQASRRCC

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_133685
ORF Size 585 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Reference Data
RefSeq NM_133685.1
RefSeq Size 3476 bp
RefSeq ORF 588 bp
Locus ID 106572
UniProt ID Q921E2
Gene Summary The small GTPases Rab are key regulators of intracellular membrane trafficking, from the formation of transport vesicles to their fusion with membranes. Rabs cycle between an inactive GDP-bound form and an active GTP-bound form that is able to recruit to membranes different set of downstream effectors directly responsible for vesicle formation, movement, tethering and fusion. Required for the integrity and for normal function of the Golgi apparatus and the trans-Golgi network. Plays a role in insulin-stimulated translocation of GLUT4 to the cell membrane. Plays a role in the maturation of phagosomes that engulf pathogens, such as S.aureus and Mycobacterium (By similarity). Plays a role in M6PR transport from the trans-Golgi network to endosomes. Plays a role in the internalization of EGFR from the cell membrane into endosomes.[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Other Versions

Customer Reviews 
Loading...