Srsf10 (NM_010178) Mouse Tagged ORF Clone

CAT#: MG225665

  • TrueORF®

Srsf10 (tGFP-tagged) - Mouse serine/arginine-rich splicing factor 10 (Srsf10) transcript variant 1, (10ug)

ORF Plasmid: DDK tGFP



  "NM_010178" in other vectors (3)

Need custom modification / cloning service?
Get a free quote

Mouse Protein / Lysate Request

CNY 2,090.00


货期*
3周

规格
    • 10 ug

Product images

经常一起买 (4)
pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
    • 10 ug

CNY 6,080.00


Mouse monoclonal turboGFP antibody, clone OTI2H8
    • 100 ul

CNY 1,000.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

CNY 1,280.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

CNY 480.00

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag TurboGFP
Synonyms Fusip1; FUSIP2; Nssr; NSSR1; NSSR2; Sfrs13a; SRrp40; Srsf13a; TASR; TASR1; TASR2
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MG225665 representing NM_010178
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCCCGATACCTGCGCCCCCCTAACACGTCTCTGTTCGTCAGGAACGTGGCGGACGACACCAGGTCTG
AAGATTTACGTCGGGAATTTGGTCGTTATGGTCCAATAGTAGATGTTTATGTCCCACTTGATTTCTACAC
TCGGCGTCCAAGAGGATTTGCATATGTTCAATTTGAGGATGTTCGTGATGCTGAAGACGCTTTACATAAT
TTGGACAGAAAATGGATTTGTGGGCGTCAGATTGAAATCCAGTTCGCACAGGGGGATCGGAAGACACCAA
ATCAAATGAAAGCCAAGGAAGGGAGGAATGTATACAGCTCTTCACGATATGACGATTATGACCGATATAG
ACGCTCTCGAAGCCGGAGTTATGAAAGGAGAAGATCGAGGAGTCGCTCCTTTGATTATAACTATAGGAGA
TCTTACAGTCCTAGAAACAGTAGACCGACTGGAAGACCACGGCGTAGCCGAAGCCATTCCGACAATGATA
GACCAAACTGCAGCTGGAATACCCAGTACAGTTCTGCTTACTACACTTCAAGAAAGATC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>MG225665 representing NM_010178
Red=Cloning site Green=Tags(s)

MSRYLRPPNTSLFVRNVADDTRSEDLRREFGRYGPIVDVYVPLDFYTRRPRGFAYVQFEDVRDAEDALHN
LDRKWICGRQIEIQFAQGDRKTPNQMKAKEGRNVYSSSRYDDYDRYRRSRSRSYERRRSRSRSFDYNYRR
SYSPRNSRPTGRPRRSRSHSDNDRPNCSWNTQYSSAYYTSRKI

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_010178
ORF Size 549 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_010178.3
RefSeq Size 3415 bp
RefSeq ORF 552 bp
Locus ID 14105
UniProt ID Q9R0U0
Gene Summary Splicing factor that in its dephosphorylated form acts as a general repressor of pre-mRNA splicing. Seems to interfere with the U1 snRNP 5'-splice recognition of SNRNP70. Required for splicing repression in M-phase cells and after heat shock. Also acts as a splicing factor that specifically promotes exon skipping during alternative splicing. Interaction with YTHDC1, a RNA-binding protein that recognizes and binds N6-methyladenosine (m6A)-containing RNAs, prevents SRSF10 from binding to its mRNA-binding sites close to m6A-containing regions, leading to inhibit exon skipping during alternative splicing (By similarity). May be involved in regulation of alternative splicing in neurons (PubMed:10583508).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Other Versions

Customer Reviews 
Loading...