Snw1 (BC049245) Mouse Tagged ORF Clone
CAT#: MR200327
- TrueORF®
(Myc-DDK-tagged) - Mouse cDNA clone MGC:55033 IMAGE:4949466
ORF Plasmid: tGFP
"BC049245" in other vectors (4)
Need custom modification / cloning service?
Get a free quote
CNY 1,200.00
CNY 2,945.00
CNY 300.00
Specifications
Product Data | |
Type | Mouse Tagged ORF Clone |
Tag | Myc-DDK |
Synonyms | 2310008B08Rik; AW048543; NCoA-62; Skiip; SKIP |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>MR200327 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGCTGGAGCCAAGTGCTAATATGCCTTGGTTCAAGGGATGGAAAGTCACCTGCAAAGATGGCAGTGCCA GTGGCACCACTCTGCTGGAAGCCAGGATAAAGACCAACAGATTTGTTCCTGATAAGGAGTTTTCTGGATC AGACCGCAAACAGAGAGGCCGAGAAGGACCAGTGCAGTTTGAGGAGGATCCTTTTGGTTTGGACAAGTTT TTGGAAGAAGCCAAACAGCACGGTGGTTCTAAAAGACCCTCTGATAGCAGTCGCCCCAAGGAACATGAGC ATGAAGGCAAGAAGCGGAGGAAAGAG ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >MR200327 protein sequence
Red=Cloning site Green=Tags(s) MLEPSANMPWFKGWKVTCKDGSASGTTLLEARIKTNRFVPDKEFSGSDRKQRGREGPVQFEEDPFGLDKF LEEAKQHGGSKRPSDSSRPKEHEHEGKKRRKE myc-FLAG tag |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | BC049245 |
ORF Size | 306 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Note | Plasmids are not sterile. For experiments where strict sterility is required, filtration with 0.22um filter is required. |
Reference Data | |
RefSeq | BC049245, AAH49245 |
RefSeq Size | 935 bp |
RefSeq ORF | 308 bp |
Locus ID | 66354 |
MW | 11.7 kDa |
Gene Summary | Involved in pre-mRNA splicing as component of the spliceosome. Is required in the specific splicing of CDKN1A pre-mRNA; the function probably involves the recruitment of U2AF2 to the mRNA. Is proposed to recruit PPIL1 to the spliceosome. May be involved in cyclin-D1/CCND1 mRNA stability through the SNARP complex which associates with both the 3'end of the CCND1 gene and its mRNA. Involved in transcriptional regulation. Modulates TGF-beta-mediated transcription via association with SMAD proteins, MYOD1-mediated transcription via association with PABPN1, RB1-mediated transcriptional repression, and retinoid-X receptor (RXR)- and vitamin D receptor (VDR)-dependent gene transcription in a cell line-specific manner probably involving coactivators NCOA1 and GRIP1. Is involved in NOTCH1-mediated transcriptional activation. Binds to multimerized forms of Notch intracellular domain (NICD) and is proposed to recruit transcriptional coactivators such as MAML1 to form an intermediate preactivation complex which associates with DNA-bound CBF-1/RBPJ to form a transcriptional activation complex by releasing SNW1 and redundant NOTCH1 NICD.[UniProtKB/Swiss-Prot Function] |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
MC206818 | (untagged) - Mouse cDNA clone MGC:55033 IMAGE:4949466, (10ug) |
CNY 3,230.00 |
|
MG200327 | (tGFP-tagged) - Mouse cDNA clone MGC:55033 IMAGE:4949466 |
CNY 2,850.00 |
|
MR200327L3 | Lenti ORF clone of MGC:55033 (Myc-DDK-tagged) - Mouse cDNA clone MGC:55033 IMAGE:4949466 |
CNY 4,750.00 |
|
MR200327L4 | Lenti ORF clone of MGC:55033 (mGFP-tagged) - Mouse cDNA clone MGC:55033 IMAGE:4949466 |
CNY 4,750.00 |