Egln1 (NM_053207) Mouse Tagged ORF Clone
CAT#: MR200656
- TrueORF®
Egln1 (Myc-DDK-tagged) - Mouse EGL nine homolog 1 (C. elegans) (Egln1)
ORF Plasmid: tGFP
"NM_053207" in other vectors (4)
Need custom modification / cloning service?
Get a free quote
CNY 1,800.00
CNY 300.00
Specifications
Product Data | |
Type | Mouse Tagged ORF Clone |
Tag | Myc-DDK |
Synonyms | AI503754; C1orf12; Hif-p4h-2; HIF-PH2; HPH-2; ORF13; Phd2; SM-20 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>MR200656 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGTTGCTTGTTACCCAGGCAACGGAACAGGCTATGTCCGTCACGTTGATAACCCAAATGGAGATGGAA GATGCGTGACATGTATATATTATCTAAATAAAGACTGGGACGCCAAGGTAAGTGGAGGTATTCTTCGAAT TTTTCCAGAAGGCAAAGCCCAGTTTGCTGACATTGAACCCAAATTTGATAGACTGCTGTTTTTCTGGTCT GACCGGCGTAACCCTCATGAAGTACAGCCAGCATACGCCACAAGGTACGCAATAACTGTTTGGTATTTTG ATGCAGATGAGCGAGCGAGAGCTAAAGTAAAATATCTAACAGGTGAGAAAGGTGTGAGGGTTGAACTCAA GCCCAATTCAGTCAGCAAAGACGTC ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >MR200656 protein sequence
Red=Cloning site Green=Tags(s) MVACYPGNGTGYVRHVDNPNGDGRCVTCIYYLNKDWDAKVSGGILRIFPEGKAQFADIEPKFDRLLFFWS DRRNPHEVQPAYATRYAITVWYFDADERARAKVKYLTGEKGVRVELKPNSVSKDV myc-FLAG tag |
Restriction Sites |
SgfI-MluI
Cloning Scheme for this gene
Plasmid Map
![]() |
ACCN | NM_053207 |
ORF Size | 378 bp |
OTI Disclaimer | Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery. The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_053207.1, NP_444437.1 |
RefSeq Size | 3524 bp |
RefSeq ORF | 1203 bp |
Locus ID | 112405 |
UniProt ID | Q91YE3 |
MW | 14.3 kDa |
Gene Summary | Cellular oxygen sensor that catalyzes, under normoxic conditions, the post-translational formation of 4-hydroxyproline in hypoxia-inducible factor (HIF) alpha proteins. Hydroxylates a specific proline found in each of the oxygen-dependent degradation (ODD) domains (N-terminal, NODD, and C-terminal, CODD) of HIF1A. Also hydroxylates HIF2A. Has a preference for the CODD site for both HIF1A and HIF1B. Hydroxylated HIFs are then targeted for proteasomal degradation via the von Hippel-Lindau ubiquitination complex. Under hypoxic conditions, the hydroxylation reaction is attenuated allowing HIFs to escape degradation resulting in their translocation to the nucleus, heterodimerization with HIF1B, and increased expression of hypoxy-inducible genes. EGLN1 is the most important isozyme under normoxia and, through regulating the stability of HIF1, involved in various hypoxia-influenced processes such as angiogenesis in retinal and cardiac functionality. Target proteins are preferentially recognized via a LXXLAP motif.[UniProtKB/Swiss-Prot Function] |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
MC207840 | Egln1 (untagged) - Mouse EGL nine homolog 1 (C. elegans) (Egln1), (10ug) |
CNY 1,800.00 |
|
MG200656 | Egln1 (tGFP-tagged) - Mouse EGL nine homolog 1 (C. elegans) (Egln1) |
CNY 3,400.00 |
|
MR200656L3 | Lenti ORF clone of Egln1 (Myc-DDK-tagged) - Mouse EGL nine homolog 1 (C. elegans) (Egln1) |
CNY 5,890.00 |
|
MR200656L4 | Lenti ORF clone of Egln1 (mGFP-tagged) - Mouse EGL nine homolog 1 (C. elegans) (Egln1) |
CNY 4,200.00 |