Dgcr6 (BC048503) Mouse Tagged ORF Clone

CAT#: MR201357

  • TrueORF®

Dgcr6 (Myc-DDK-tagged) - Mouse DiGeorge syndrome critical region gene 6 (cDNA clone MGC:58370 IMAGE:6770478)

ORF Plasmid: DDK tGFP



  "BC048503" in other vectors (4)

Need custom modification / cloning service?
Get a free quote

Mouse Protein / Lysate Request

CNY 1,900.00


货期*
4周

规格
    • 10 ug

Product images

经常一起买 (4)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

CNY 5,420.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

CNY 1,280.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

CNY 480.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

CNY 300.00

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag Myc-DDK
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MR201357 representing BC048503
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCGGCCGCCGGGGATGAGGCGGCGGATCGGGTCCTACACCACGCTCAGCGACTTGGCCCTGGCGCTGC
TCGACGGAACGGTGTTTGAAATCGTGCAGGGTCTTCTGGAGATTCAGCACCTCACTGAGAAGAGCCTCTA
CAACCAGAGACTGCGGCTGCAGAACGAACACCGAGTGCTCAGACAGACTCTAAGGCAGAAGCACCTGGAA
GCCCAGCAGTCCTGCCGGCCCCACAACTTGCCAGTGCTCCAGGCAGCTCAGCAGCGTGAGCTGGAGGCCA
TGGAACATCGGATCCGGGAGGAGCAGCAGGCTATGGACCGAAAGATTGTCCTGGAGCTGGACCGGAAGGT
TGCCGACCAGCAGAGCACACTGGAGAAGGCAGGGGTAGCTGGTTTCTACGTGACCACCAATCCTCAGGAG
CTGACGCTGCAGATGAACCTATTGGAACTCATCAGGAAGCTGCAGCAGAGGGGCTGCCAAGTGGGAAAGG
CAGCTCTG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR201357 representing BC048503
Red=Cloning site Green=Tags(s)

MRPPGMRRRIGSYTTLSDLALALLDGTVFEIVQGLLEIQHLTEKSLYNQRLRLQNEHRVLRQTLRQKHLE
AQQSCRPHNLPVLQAAQQRELEAMEHRIREEQQAMDRKIVLELDRKVADQQSTLEKAGVAGFYVTTNPQE
LTLQMNLLELIRKLQQRGCQVGKAAL

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN BC048503
ORF Size 498 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq BC048503.1
RefSeq Size 948 bp
RefSeq ORF 500 bp
Locus ID 13353
MW 34.8 kDa
Gene Summary This gene encodes a protein that is similar to the gonadal protein in Drosophila (fruit fly). The encoded protein is thought to play a role in migration of neural crest cells during development. Deletions in the human gene are associated with DiGeorge syndrome (or velocardiofacial syndrome) which has many clinical features including cardiac abnormalities, cleft palate, atypical facial features, hypocalcemia, hypoparathyroidism and defective development or congenital absence of the thymus. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2014]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Other Versions

Customer Reviews 
Loading...