Msra (BC014738) Mouse Tagged ORF Clone

CAT#: MR201871

  • TrueORF®

Msra (Myc-DDK-tagged) - Mouse methionine sulfoxide reductase A (cDNA clone MGC:25961 IMAGE:4239349)

ORF Plasmid: DDK tGFP



  "BC014738" in other vectors (4)

Need custom modification / cloning service?
Get a free quote

Mouse Protein / Lysate Request

CNY 2,400.00

CNY 2,945.00


货期*
现货

规格
    • 10 ug

Product images

经常一起买 (5)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

CNY 5,420.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

CNY 1,280.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

CNY 480.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

CNY 300.00


MSRA Antibody - middle region
    • 100 ul

CNY 5,250.00

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag Myc-DDK
Synonyms 6530413P12Rik, MSR-A
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MR201871 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCTCTCCGCCTCTAGAAGGGCTCTCCAGCTCCTCTCTAGCGCCAACCCGGTACGGAGGATGGGCGACT
CAGCTTCGAAAGTCATCTCCGCAGAGGAAGCCTTGCCGGGACGCACCGAGCCGATCCCTGTAACAGCCAA
ACACCATGTCAGTGGCAACAGAACGGTTGAACCTTTCCCAGAGGGAACACAGATGGCTGTATTTGAAAAA
ACTGGCCACGCCGAAGTCGTCCGGGTTGTGTACCGGCCAGAGCACATCAGCTTTGAGGAACTGCTCAAGG
TCTTCTGGGAGAATCACGACCCGACCCAAGGCATGCGCCAAGGCAATGACTTTGGTACACAGTACCGGTC
AGCAGTCTATCCCACATCCGCCGTGCAGATGGAAGCAGCCCTGAGATCCAAGGAAGAATACCAAAAGGTT
CTTTCAAAGCATAACTTTGGCCCCATCACCACCGACATCCGAGAGGGACAAGTGTTCTACTATGCCGAAG
ACTACCACCAGCAATACCTGAGCAAGAACCCAGACGGCTACTGTGGCCTCGGGGGTACTGGAGTTTCCTG
CCCGATGGCCATTAAAAAA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR201871 protein sequence
Red=Cloning site Green=Tags(s)

MLSASRRALQLLSSANPVRRMGDSASKVISAEEALPGRTEPIPVTAKHHVSGNRTVEPFPEGTQMAVFEK
TGHAEVVRVVYRPEHISFEELLKVFWENHDPTQGMRQGNDFGTQYRSAVYPTSAVQMEAALRSKEEYQKV
LSKHNFGPITTDIREGQVFYYAEDYHQQYLSKNPDGYCGLGGTGVSCPMAIKK

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN BC014738
ORF Size 579 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Reference Data
RefSeq BC014738, AAH14738
RefSeq Size 1300 bp
RefSeq ORF 581 bp
Locus ID 110265
MW 21.6 kDa
Gene Summary Has an important function as a repair enzyme for proteins that have been inactivated by oxidation. Catalyzes the reversible oxidation-reduction of methionine sulfoxide in proteins to methionine (By similarity).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Other Versions

Customer Reviews 
Loading...