Cd8a (BC030679) Mouse Tagged ORF Clone
CAT#: MR202198
- TrueORF®
Cd8a (Myc-DDK-tagged) - Mouse CD8 antigen, alpha chain (cDNA clone MGC:41580 IMAGE:1247019)
ORF Plasmid: tGFP
"BC030679" in other vectors (6)
Need custom modification / cloning service?
Get a free quote
CNY 2,400.00
CNY 2,945.00
CNY 300.00
Specifications
Product Data | |
Type | Mouse Tagged ORF Clone |
Tag | Myc-DDK |
Synonyms | BB154331; Ly-2; Ly-35; Ly-B; Lyt-2 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>MR202198 representing BC030679
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGACGCCGAACTTGGTCAGAAGGTGGACCTGGTATGTGAAGTGTTGGGGTCCGTTTCGCAAGGATGCT CTTGGCTCTTCCAGAACTCCAGCTCCAAACTCCCCCAGCCCACCTTCGTTGTCTATATGGCTTCATCCCA CAACAAGATAACGTGGGACGAGAAGCTGAATTCGTCGAAACTGTTTTCTGCCATGAGGGACACGAATAAT AAGTACGTTCTCACCCTGAACAAGTTCAGCAAGGAAAACGAAGGCTACTATTTCTGCTCAGTCATCAGCA ACTCGGTGATGTACTTCAGTTCTGTCGTGCCAGTCCTTCAGAAAGTGAACTCTACTACTACCAAGCCAGT GCTGCGAACTCCCTCACCTGTGCACCCTACCGGGACATCTCAGCCCCAGAGACCAGAAGATTGTCGGCCC CGTGGCTCAGTGAAGGGGACCGGATTGGACTTCGCCTGTGATATTTACATCTGGGCACCCTTGGCCGGAA TCTGCGTGGCCCTTCTGCTGTCCTTGATCATCACTCTCATCTGCTACCACAGGAGCCGAAAGCGTGTTTG CAAATGTCCCAGGCCGCTAGTCAGACAGGAAGGCAAGCCCAGACCTTCAGAGAAAATTGTG ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >MR202198 representing BC030679
Red=Cloning site Green=Tags(s) MDAELGQKVDLVCEVLGSVSQGCSWLFQNSSSKLPQPTFVVYMASSHNKITWDEKLNSSKLFSAMRDTNN KYVLTLNKFSKENEGYYFCSVISNSVMYFSSVVPVLQKVNSTTTKPVLRTPSPVHPTGTSQPQRPEDCRP RGSVKGTGLDFACDIYIWAPLAGICVALLLSLIITLICYHRSRKRVCKCPRPLVRQEGKPRPSEKIV myc-FLAG tag |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | BC030679 |
ORF Size | 621 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Note | Plasmids are not sterile. For experiments where strict sterility is required, filtration with 0.22um filter is required. |
Reference Data | |
RefSeq | BC030679, AAH30679 |
RefSeq Size | 1452 bp |
RefSeq ORF | 623 bp |
Locus ID | 12525 |
MW | 53.2 kDa |
Gene Summary | Integral membrane glycoprotein that plays an essential role in the immune response and serves multiple functions in responses against both external and internal offenses. In T-cells, functions primarily as a coreceptor for MHC class I molecule:peptide complex. The antigens presented by class I peptides are derived from cytosolic proteins while class II derived from extracellular proteins. Interacts simultaneously with the T-cell receptor (TCR) and the MHC class I proteins presented by antigen presenting cells (APCs). In turn, recruits the Src kinase LCK to the vicinity of the TCR-CD3 complex. LCK then initiates different intracellular signaling pathways by phosphorylating various substrates ultimately leading to lymphokine production, motility, adhesion and activation of cytotoxic T-lymphocytes (CTLs). This mechanism enables CTLs to recognize and eliminate infected cells and tumor cells. In NK-cells, the presence of CD8A homodimers at the cell surface provides a survival mechanism allowing conjugation and lysis of multiple target cells. CD8A homodimer molecules also promote the survival and differentiation of activated lymphocytes into memory CD8 T-cells.[UniProtKB/Swiss-Prot Function] |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
MC206824 | Cd8a (untagged) - Mouse CD8 antigen, alpha chain (cDNA clone MGC:41580 IMAGE:1247019), (10ug) |
CNY 2,400.00 |
|
MG202198 | Cd8a (tGFP-tagged) - Mouse CD8 antigen, alpha chain (cDNA clone MGC:41580 IMAGE:1247019) |
CNY 4,000.00 |
|
MR202198L1 | Lenti ORF clone of Cd8a (Myc-DDK-tagged) - Mouse CD8 antigen, alpha chain (cDNA clone MGC:41580 IMAGE:1247019) |
CNY 4,800.00 |
|
MR202198L2 | Lenti ORF clone of Cd8a (mGFP-tagged) - Mouse CD8 antigen, alpha chain (cDNA clone MGC:41580 IMAGE:1247019) |
CNY 4,750.00 |
|
MR202198L3 | Lenti ORF clone of Cd8a (Myc-DDK-tagged) - Mouse CD8 antigen, alpha chain (cDNA clone MGC:41580 IMAGE:1247019) |
CNY 4,750.00 |
|
MR202198L4 | Lenti ORF clone of Cd8a (mGFP-tagged) - Mouse CD8 antigen, alpha chain (cDNA clone MGC:41580 IMAGE:1247019) |
CNY 4,750.00 |