Psmc3ip (NM_008949) Mouse Tagged ORF Clone

CAT#: MR202419

  • TrueORF®

Psmc3ip (Myc-DDK-tagged) - Mouse proteasome (prosome, macropain) 26S subunit, ATPase 3, interacting protein (Psmc3ip)

ORF Plasmid: DDK tGFP



  "NM_008949" in other vectors (4)

Need custom modification / cloning service?
Get a free quote

Mouse Protein / Lysate Request

CNY 2,400.00


货期*
现货

规格
    • 10 ug

Product images

经常一起买 (4)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

CNY 5,420.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

CNY 1,280.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

CNY 480.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

CNY 300.00

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag Myc-DDK
Synonyms C79099; GT198; HOP2; Tbpip
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MR202419 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGTAAAAGCCGGGCCGAGGCTGCGGCTGGAGCCCCCGGGATCATCCTGAGGTACCTGCAAGAACAAA
ACCGGCCCTACAGCGCCCAGGACGTGTTCGGAAACCTACAGAAGGAACATGGACTGGGCAAGGCGGCGGT
AGTGAAGGCGCTGGATCAGCTGGCCCAGGAAGGCAAGATCAAAGAGAAGACCTACGGCAAGCAGAAAATT
TATTTTGCCGATCAGAACCAGTTTGACACAGTGAGTGATGCGGACCTCCACGGCCTGGATGCCAGTATCG
TGGCCCTCACTGCCAAGGTGCAGAGCTTACAGCAGAGCTGCCGACACATGGAGGCCGAGCTGAAGGAATT
AACAAGTGCGCTGACCACTCCTGAGATGCAGAAAGAGATTCAGGAGTTAAAGAAGGAGTGTGCTCAATAC
ACAGAGAGACTGAAGAACATCAAAGCAGCTACCAACCATGTCACTCCAGAAGAGAAGGAGAAGGTGTACA
GAGACAGACAGAAGTACTGTAAAGAGTGGAGGAAGCGGAAGAGGATGACCACAGAGCTGTGTGATGCGAT
CCTTGAAGGCTACCCCAAGAGCAAGAAGCAGTTCTTTGAGGAAGTTGGAATAGAGACAGATGAAGATCAT
AATGTTTTGCTCCCCGACCCC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR202419 protein sequence
Red=Cloning site Green=Tags(s)

MSKSRAEAAAGAPGIILRYLQEQNRPYSAQDVFGNLQKEHGLGKAAVVKALDQLAQEGKIKEKTYGKQKI
YFADQNQFDTVSDADLHGLDASIVALTAKVQSLQQSCRHMEAELKELTSALTTPEMQKEIQELKKECAQY
TERLKNIKAATNHVTPEEKEKVYRDRQKYCKEWRKRKRMTTELCDAILEGYPKSKKQFFEEVGIETDEDH
NVLLPDP

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_008949
ORF Size 654 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_008949.3
RefSeq Size 984 bp
RefSeq ORF 654 bp
Locus ID 19183
UniProt ID O35047
MW 24.7 kDa
Gene Summary Plays an important role in meiotic recombination. Stimulates DMC1-mediated strand exchange required for pairing homologous chromosomes during meiosis. The complex PSMC3IP/MND1 binds DNA, stimulates the recombinase activity of DMC1 as well as DMC1 D-loop formation from double-strand DNA. This complex stabilizes presynaptic RAD51 and DMC1 filaments formed on single strand DNA to capture double-strand DNA. This complex stimulates both synaptic and presynaptic critical steps in RAD51 and DMC1-promoted homologous pairing. May inhibit HIV-1 viral protein TAT activity and modulate the activity of proteasomes through association with PSMC3.[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Other Versions

Customer Reviews 
Loading...