Cidec (NM_178373) Mouse Tagged ORF Clone

CAT#: MR202932

  • TrueORF®

Cidec (Myc-DDK-tagged) - Mouse cell death-inducing DFFA-like effector c (Cidec)

ORF Plasmid: DDK tGFP



  "NM_178373" in other vectors (4)

Need custom modification / cloning service?
Get a free quote

Mouse Protein / Lysate Request

CNY 3,600.00


货期*
现货

规格
    • 10 ug

Product images

经常一起买 (3)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

CNY 5,420.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

CNY 480.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

CNY 300.00

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag Myc-DDK
Synonyms CIDE-3; Fsp27
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MR202932 representing NM_178373
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGACTATGCCATGAAGTCTCTCAGCCTCCTGTACCCCAGGTCGCTGTCCAGGCATGTGGCAGTGAGCA
CGGCAGTGGTGACCCAACAGCTGGTGTCTAAGCCCAGCCGGGAGACCCCGAGGGCCAGGCCCTGTCGTGT
TAGCACCGCAGATCGGAAGGTTCGCAAAGGCATCATGGCTCACAGCTTGGAGGACCTCCTGAACAAGGTC
CAGGACATCTTGAAACTTAAAGACAAGCCCTTCTCCCTGGTGCTGGAGGAAGATGGCACAATCGTGGAGA
CAGAAGAATACTTCCAAGCCCTGGCAAAAGATACCATGTTCATGGTCCTGCTGAAGGGGCAGAAGTGGAA
GCCCCCATCAGAACAGCGCAAGAAGAGAGCCCAGCTAGCCCTTTCCCAGAAGCCAACTAAGAAGATCGAT
GTGGCCCGGGTAACCTTCGACCTGTACAAGCTGAACCCTCAGGACTTTATTGGCTGCCTGAACGTGAAGG
CAACCCTCTATGACACATACTCGCTTTCCTATGACCTGCACTGCTACAAGGCCAAGCGCATCGTGAAGGA
GATGCTCCGCTGGACCCTCTTCAGCATGCAGGCCACCGGTCACATGCTGCTTGGCACCTCCAGCTACATG
CAGCAGTTCCTGGATGCCACCGAGGAAGAACAGCCTGCCAAGGCCAAGCCCTCCTCCCTCCTCCCAGCCT
GTCTGAAGATGCTGCAA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR202932 representing NM_178373
Red=Cloning site Green=Tags(s)

MDYAMKSLSLLYPRSLSRHVAVSTAVVTQQLVSKPSRETPRARPCRVSTADRKVRKGIMAHSLEDLLNKV
QDILKLKDKPFSLVLEEDGTIVETEEYFQALAKDTMFMVLLKGQKWKPPSEQRKKRAQLALSQKPTKKID
VARVTFDLYKLNPQDFIGCLNVKATLYDTYSLSYDLHCYKAKRIVKEMLRWTLFSMQATGHMLLGTSSYM
QQFLDATEEEQPAKAKPSSLLPACLKMLQ

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_178373
ORF Size 717 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_178373.1, NM_178373.2, NM_178373.3, NP_848460.1
RefSeq Size 1704 bp
RefSeq ORF 720 bp
Locus ID 14311
UniProt ID P56198
MW 27.8 kDa
Gene Summary Binds to lipid droplets and regulates their enlargement, thereby restricting lipolysis and favoring storage. At focal contact sites between lipid droplets, promotes directional net neutral lipid transfer from the smaller to larger lipid droplets. The transfer direction may be driven by the internal pressure difference between the contacting lipid droplet pair. Its role in neutral lipid transfer and lipid droplet enlargement is activated by the interaction with PLIN1. May act as a CEBPB coactivator in the white adipose tissue to control the expression of a subset of CEBPB downstream target genes, including SOCS1, SOCS3, TGFB1, TGFBR1, ID2 and XDH. When overexpressed in preadipocytes, induces apoptosis or increases cell susceptibility to apoptosis induced by serum deprivation or TGFB treatment. As mature adipocytes, that express high CIDEC levels, are quite resistant to apoptotic stimuli, the physiological significance of its role in apoptosis is unclear. May play a role in the modulation of the response to osmotic stress by preventing NFAT5 to translocate into the nucleus and activate its target genes expression.[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Other Versions

Customer Reviews 
Loading...