Tardbp (NM_001003899) Mouse Tagged ORF Clone

CAT#: MR204079

  • TrueORF®

Tardbp (Myc-DDK-tagged) - Mouse TAR DNA binding protein (Tardbp), transcript variant 3

ORF Plasmid: DDK tGFP



  "NM_001003899" in other vectors (4)

Need custom modification / cloning service?
Get a free quote

Mouse Protein / Lysate Request

CNY 2,400.00


货期*
现货

规格
    • 10 ug

Product images

经常一起买 (4)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

CNY 5,420.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

CNY 1,280.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

CNY 480.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

CNY 300.00

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag Myc-DDK
Synonyms 1190002A23Rik; C85084; TDP-43; Tdp43
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MR204079 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCTGAATATATTCGGGTAACAGAAGATGAGAACGATGAACCCATTGAAATACCATCAGAAGACGATG
GGACGGTGTTGCTGTCCACAGTTACAGCCCAGTTTCCAGGGGCATGCGGCCTGCGCTACCGGAATCCCGT
GTCTCAGTGTATGAGAGGAGTCCGACTGGTGGAAGGAATTCTGCATGCCCCAGATGCTGGCTGGGGCAAT
CTGGTATATGTTGTCAACTATCCCAAAGATAACAAAAGGAAAATGGATGAGACAGATGCTTCCTCTGCAG
TGAAAGTGAAAAGAGCAGTCCAGAAAACATCTGACCTCATAGTGTTGGGTCTCCCCTGGAAAACAACTGA
GCAGGATCTGAAAGACTATTTCAGTACTTTTGGAGAGGTTCTTATGGTTCAGGTCAAGAAAGATCTTAAA
ACTGGTCACTCGAAAGGGTTTGGCTTTGTTCGATTTACAGAATATGAAACCCAAGTGAAAGTAATGTCAC
AACGACATATGATAGATGGGCGATGGTGTGACTGTAAACTTCCCAACTCTAAGCAAAGCCCAGACGAGCC
TTTGAGAAGCAGAAAGGTGTTTGTTGGACGTTGTACAGAGGACATGACTGCTGAAGAGCTTCAGCAGTTT
TTCTGTCAGTATGGAGAAGTGGTAGATGTCTTCATTCCCAAACCATTCAGAGCTTTTGCCTTCGTCACCT
TTGCAGATGATAAGGTTGCCCAGTCTCTTTGTGGAGAGGATTTGATCATTAAAGGAATCAGCGTGCATAT
ATCCAATGCTGAACCTAAGCATAATAGCAATAGACAGTTAGAAAGAAGTGGAAGATTTGGTGTTCATCTC
ATTTCAAATGTTTATGGAAGAAGCACTTCATTGAAAGTAGTGCTG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR204079 protein sequence
Red=Cloning site Green=Tags(s)

MSEYIRVTEDENDEPIEIPSEDDGTVLLSTVTAQFPGACGLRYRNPVSQCMRGVRLVEGILHAPDAGWGN
LVYVVNYPKDNKRKMDETDASSAVKVKRAVQKTSDLIVLGLPWKTTEQDLKDYFSTFGEVLMVQVKKDLK
TGHSKGFGFVRFTEYETQVKVMSQRHMIDGRWCDCKLPNSKQSPDEPLRSRKVFVGRCTEDMTAEELQQF
FCQYGEVVDVFIPKPFRAFAFVTFADDKVAQSLCGEDLIIKGISVHISNAEPKHNSNRQLERSGRFGVHL
ISNVYGRSTSLKVVL

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001003899
ORF Size 888 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Reference Data
RefSeq NM_001003899.2
RefSeq Size 6486 bp
RefSeq ORF 888 bp
Locus ID 230908
UniProt ID Q921F2
MW 33.3 kDa
Gene Summary RNA-binding protein that is involved in various steps of RNA biogenesis and processing. Preferentially binds, via its two RNA recognition motifs RRM1 and RRM2, to GU-repeats on RNA molecules predominantly localized within long introns and in the 3' UTR of mRNAs. In turn, regulates the splicing of many non-coding and protein-coding RNAs including proteins involved in neuronal survival, as well as mRNAs that encode proteins relevant for neurodegenerative diseases. Plays a role in maintaining mitochondrial homeostasis by regulating the processing of mitochondrial transcripts. Regulates also mRNA stability by recruiting CNOT7/CAF1 deadenylase on mRNA 3' UTR leading to poly(A) tail deadenylation and thus shortening. In response to oxidative insult, associates with stalled ribosomes localized to stress granules (SGs) and contributes to cell survival. Participates also in the normal skeletal muscle formation and regeneration, forming cytoplasmic myo-granules and binding mRNAs that encode sarcomeric proteins. Plays a role in the maintenance of the circadian clock periodicity via stabilization of the CRY1 and CRY2 proteins in a FBXL3-dependent manner (PubMed:27123980).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Other Versions

Customer Reviews 
Loading...